Asien

Asien
AfrikaEuropaAustralien und OzeanienNordamerikaAsienLage Asiens auf einer Weltkarte
Über dieses Bild
Fläche44.614.500 km²
Bevölkerungca. 4 Milliarden
Bevölkerungsdichte90 Einwohner/km²
Länder47 international anerkannt
ZeitzonenUTC+2 (Türkei) bis UTC+12 (Russland)

Asien, Teil von Eurasien, ist mit rund 44,6 Millionen Quadratkilometern, etwa einem Drittel der gesamten Landmasse, der flächenmäßig größte Erdteil. Mit über vier Milliarden Menschen, mehr als der Hälfte der Weltbevölkerung, ist dieser Erdteil auch der einwohnerstärkste. Es gibt 47 international anerkannte Staaten Asiens.

Menschheitsgeschichtlich spielte Asien früh eine wichtige Rolle. Hier entstanden bereits um 900 v. Chr. mit dem Neuassyrischen Reich oder 500 v. Chr. mit dem noch größeren Achämenidenreich die ersten Großreiche.

Etymologie

Das Wort „Asien“ geht über das lateinische Asia auf griechisch Ἀσία (Asía) zurück. Über die weitere Herkunft kann bis heute nur spekuliert werden. Angenommen wird meist eine Herkunft vom assyrischen assu „Sonnenaufgang, Osten“.[1] Der Name Asía würde demnach eine östliche Region benennen, die in der Richtung des Sonnenaufgangs liegt, und entspräche darin dem lateinischen Wort Orient oder dem deutschen „Morgenland“. Die frühen Griechen nannten zunächst nur die Landmasse Kleinasiens Asien, woraus sich später auch der Name der römischen Provinz Asia ergab. Von Plinius dem Älteren (Naturalis historia, um 77 n. Chr.) wurde der Name dann auch auf den größeren Kontinent bezogen. Langfristig wurde so das alte Asia zu Asia minor.

In der griechischen Mythologie war Asia der Name einer Okeanide (oder auch Mutter einer solchen bei Hesiod), nach der wiederum die geographische Region benannt worden sein sollte. Nach Aischylos (Promētheús desmṓtēs, um 470 v. Chr.) ist sie zudem die Gattin des Titanen Iapetos und Mutter des Prometheus, nach Herodot (Historien, 5. Jahrhundert v. Chr.) dessen Gattin.

Im heutigen allgemeinen Sprachgebrauch beziehen sich die Begriffe asiatisch und Asiaten vor allem auf Dinge und Menschen ost- oder südostasiatischer Herkunft, so beispielsweise in Bezug auf Küche, Philosophie oder Architektur, bisweilen unter dem Einschluss Indiens, während sich die Begriffe nur sehr selten auch auf die Länder westlich von Indien beziehen. Während Westasien schon seit dem Altertum in engem Kontakt mit Europa stand, war dies mit Ostasien nicht der Fall, sodass diese Region in Europa über Jahrhunderte den Inbegriff von Fremdheit darstellte, auch da sich Länder wie China und Japan gegenüber der Außenwelt abgrenzten und nur begrenztes Interesse an Austausch zeigten (vgl. Sinozentrismus, Abschließung Japans).

Geographie

Satellitenbild Asiens

Asien ist der größte Kontinent der Erde. Mit ca. 44,6 Millionen Quadratkilometer Fläche (ohne Russland 31,7 Millionen Quadratkilometer) umfasst er rund ein Drittel der gesamten Landmasse. Gemeinsam mit Europa wird Asien auch als Teil des Großkontinents Eurasien betrachtet.

Die kontinentale Landmasse liegt ganz in der östlichen Hemisphäre und nördlich des Äquators mit Ausnahme der südöstlichsten Inseln im Malaiischen Archipel, die sich auf der Südhalbkugel der Erde befinden. Die Tschuktschen-Halbinsel in Ostsibirien liegt zwar östlich des 180. Breitengrades, es gilt aber die östliche Zeit +12h.

Ausdehnung

Asien wird im Norden vom Arktischen Ozean, im Osten vom Pazifischen Ozean und im Süden vom Indischen Ozean begrenzt.

Asien hat im Westen gegenüber Europa keine eindeutige geographische oder geologische Grenze. Die häufigste Definition der Grenze zu Europa von Nord nach Süd: das Ural-Gebirge, der Ural-Fluss, das Kaspische Meer, der Kaukasus bzw. die Manytschniederung, die Südküste des Schwarzen Meeres sowie der Bosporus, das Marmarameer und die Dardanellen. Von der Barentssee bis zum Schwarzen Meer ist diese Grenze rund 2700 km lang.

Mit Afrika ist Asien nördlich des Roten Meeres über die Halbinsel Sinai (Landenge von Sues, 145 km breit) verbunden.

Im Nordosten liegen die Festlandmassen von Asien und Nordamerika an der Beringstraße etwas mehr als 80 km voneinander entfernt. Im Südosten bildet der Malaiische Archipel die Verbindung zu Australien. Den südlichsten Punkt bildet die indonesische Insel Pamana.

Der nördlichste Festlandspunkt Asiens und der Erde ist Kap Tscheljuskin auf der Taimyrhalbinsel (77° 43′ 21″ N), der östlichste Punkt Kap Deschnjow auf der Tschuktschen-Halbinsel (169° 39′ 7″ W). Von dort bis zum westlichsten Punkt Asiens, dem Kap Baba in Kleinasien (26° 3′ 50″ O), sind es 8.223 km Luftlinie. Der südlichste Festlandspunkt des asiatischen Kontinents ist das Kap Tanjung Piai auf der Malaiischen Halbinsel (1° 15′ 57″ N).

Einteilung Asiens in Regionen durch die UNSD
  • Nordasien
  • Zentralasien
  • Vorderasien (Westasien)

  • Südasien
  • Ostasien
  • Südostasien
  • Länder Asiens

    Gliederung

    Zur regionalen Gliederung Asiens gibt es verschiedene Ansätze. Die folgende Unterteilung in Regionen wird neben anderen von der UN-Statistikbehörde UNSD verwendet. Diese Einteilung Asiens in Regionen durch die Vereinten Nationen geschieht ausschließlich aus statistischen Gründen und impliziert keine Annahme über politische oder sonstige Zugehörigkeiten der Länder und Gebiete.[2]

    In mancher Veröffentlichung werden diese Grenzen variiert, je nach Ziel, Thema und Hintergrund, für die eine Aufteilung verwendet wird. Früher war Afghanistan Zentralasien zugeordnet, jetzt zu Südasien. Darüber hinaus gibt es auch alternative bzw. zusätzliche Unterteilungen bzw. Überschneidungen, beispielsweise für Nordostasien.

    Flora und Fauna

    Die wichtigsten Vegetationszonen oder Ökozonen (von Nord nach Süd):

    Tundra im Gebiet der Nenzen am Unterlauf des Jenissei
    • Baumlose Tundra nördlich des Polarkreises. Die wichtigsten Tiere für die nomadisch lebenden Bewohner wie diejenigen der Nenzen sind die Rentiere.
    • Wälder der gemäßigten Zone, darunter der boreale Nadelwald (Taiga) in Sibirien etwa zwischen Polarkreis und Verlauf der Transsibirischen Eisenbahn sowie Laubwälder etwa im Fernen Osten und im Gebiet des Kaspischen Meers. Die vielfältige Fauna hat (historische) Bedeutung für die Jagd, neben Ackerbau und der Viehzucht hat auch die Holznutzung Bedeutung. Hier leben z. B. die seltenen Amurtiger und Amurleoparden, dazu Hirsche, Wildschweine, Luchse und Bären.
    • Kontinentale Graslandschaften oder Steppen. Zu den Tierarten, die diese Steppen natürlicherweise bewohnen, zählen Wildpferde, Saiga-Antilopen, Mongoleigazellen, Wölfe und Ziesel.
    • Vegetationsarme, felsige Gebirgslandschaften und Wüstenlandschaften. Hochlandklima mit großen Tagestemperaturschwankungen und viel Sonnenschein. Die Gebirge werden von zahlreichen Gebirgsweidetieren wie Steinböcken, Goralen, Serauen und Wildschafen bevölkert. Der wichtigste Prädator der zentralasiatischen Gebirge ist der Schneeleopard. Die Wüstengebiete sind Heimat von Halbeseln, Wildkamelen, Geparden und Gazellen.
    • Tropische Savannengebiete und Trockenwälder, vorzugsweise auf dem Indischen Subkontinent, aber auch in Südostasien. Charakteristische Großtiere sind Löwen, Hirschziegenantilopen, Nilgauantilopen und verschiedene Hirsche.
    • Tropische Regenwälder. Nach der Rodung folgt als nächster Zerstörungsschritt häufig der Anbau von Monokulturen wie Palmöl-Plantagen, z. B. in Sabah (Malaysia) auf Borneo.
    • Tropische Monsungebiete wie das Mekongdelta: Hier dominieren der Reisanbau und als Nutztiere Geflügel und Schweine sowie der Fischfang.

    Superlative

    Asien weist eine Reihe globaler geographischer Superlative auf:

    • das bevölkerungsreichste Land: China
    • den größten Anteil am weltweit flächenmäßig größten Land: Russland. Dieser Anteil Russlands selbst ist größer als das weltweit zweitgrößte Land Kanada.
    • die höchste Gebirgskette: Himalaya, alle Berge über 8000 Meter Gipfelhöhe
    • den tiefsten und ältesten Binnensee: den Baikal
    • den größten Binnensee: das Kaspische Meer
    • das tiefstgelegene Gewässer: das Tote Meer

    Es ist der Erdteil mit der verschiedenartigsten Vegetation, wechselnd vom Permafrostboden Sibiriens bis hin zum Dschungel Südostasiens. Neben den Extremen Tundra, Wüste und tropischer Regenwald sind auch alle anderen auf der Erde vertretenen Vegetationszonen in Asien zu finden.

    Eine weitere Besonderheit sind die meisten interkontinentalen Staaten der Erde, mit sowohl asiatischen Landesteilen als auch Territorien in anderen Erdteilen. Dazu gehören Russland, Kasachstan, Indonesien, Japan, Ägypten und die Türkei.

    Geschichte

    Asien ist die Wiege zahlreicher Kulturen, beispielsweise in China, in Japan, in Indien, in Iran sowie Babylonien und Assyrien in Vorderasien. Alle sogenannten Weltreligionen sind in Asien entstanden.

    Asien und Europa verbindet eine lange Tradition an Kriegen (beispielsweise Alexander der Große, die Perserkriege, die Kreuzzüge, die Einfälle der Hunnen und der Türken) und an Entdeckungsreisen (beispielsweise Sven Hedin), aber auch viele wichtige Handelsverbindungen, wie zum Beispiel die Seidenstraße.

    Asien ist von jeher von Großreichen geprägt und nicht so zersplittert wie Europa. Die chinesische Kultur hat in der Welt, vor allem jedoch in Ostasien, ihre Spuren hinterlassen (Papier, Buchdruck, Kompass, Seide, Porzellan u. v. m.). Aus Indien hat sich der Buddhismus verbreitet. Nordasien (insbesondere Sibirien) blieb lange Zeit nahezu unbesiedelt, erst als sich das Russische Reich weiter ausdehnte, wurden dort größere Städte gegründet. Zentralasien war traditionell die Heimat von Steppenvölkern (Reitervölker), (beispielsweise den Mongolen), die in früheren Zeiten eine Bedrohung für Europa darstellten. Vorderasien ist seit dem 7. Jahrhundert vom Islam geprägt und hat einen stark prägenden Einfluss auf Nordafrika gehabt.

    Bevölkerung

    Entwicklung der Bevölkerung Asiens (in Milliarden; ohne Russland, mit Türkei)[3]

    In Asien leben rund vier Milliarden Menschen, was etwa 60 % der Erdbevölkerung entspricht. Sowohl in Indien als auch in der Volksrepublik China leben je über eine Milliarde Menschen. Während vor allem Russland und die Mongolei sehr dünn besiedelt sind, kämpfen andere Länder mit den Auswirkungen ihrer Bevölkerungsexplosion.

    Weltkarte zum Thema Durchschnittsalter (Stand: 2005)
    Malariarisikogebiete mit Chemoprophylaxeempfehlungen der DTG
    HIV-Verbreitung
  • keine Daten
  • weniger als 0,1 %
  • 0,1–0,5 %
  • 0,5–1 %
  • 1–5 %
  • 5–15 %
  • 15–50 %
  • Gesundheit und Lebenserwartung korrelieren mit dem Wohlstand der Nationen. Höherer Lebensstandard bedeutet auch mehr Ressourcen für die eigene wie für die Volksgesundheit.

    Die Bewohner von Macau, Singapur, Hongkong und Japan erreichen unter den Asiaten das höchste Durchschnittsalter. Saudi-Arabien, Arabische Emirate, Brunei, China, Malaysia, Thailand, Philippinen und Indonesien liegen mit der Lebenserwartung weltweit etwa im Mittel. Die kürzeste Lebenserwartung in Asien haben Menschen in Indien, Bangladesch, Burma, Kambodscha, Laos, Bhutan und Afghanistan.[4]

    Malaria ist in Südasien und Südostasien verbreitet. Es gibt noch kein effektives Impfmittel gegen Malaria. Durch Insektensprays könnte die Verbreitung etwas eingedämmt werden, diese sind aber für große Teile der betroffenen Bevölkerung zu teuer.

    AIDS ist weit verbreitet. Besonders in Russland, Indien, Nepal, Myanmar, Thailand, Kambodscha, Vietnam und Malaysia tritt das HI-Virus vermehrt auf. Dagegen sind in Japan, der Mongolei, Sri Lanka, Bangladesch, Bhutan, Afghanistan, Turkmenistan und in Vorderasien nur relativ wenige Menschen an AIDS erkrankt. Diese Angaben sind aber mit Vorsicht zu betrachten, da die HIV-Infektionsrate als Durchschnittswert auf das ganze Land bezogen ist, aber vor allem in den Großstädten gehäuft auftritt.

    Sprachen

    In Asien werden viele hundert einzelne Sprachen gesprochen. Zu den bedeutenden Sprachfamilien und Sprachgruppen gehören (Auswahl):

    Siehe auch Abschnitt Eurasien: Europa und asiatisches Festland im Artikel Sprachfamilien der Welt.

    Wirtschaft

    Die ärmsten Staaten der Welt

    Nach der Einteilung in Nordasien (Russland), Westasien (W), Zentralasien (Z), Südasien (S), Südostasien (SO) und Ostasien (O) ergibt sich folgendes Bild:

    Industrienationen

    Die Dorasan-Station an der Grenze zwischen Nordkorea und Südkorea 2003

    Sowohl gemessen am Wechselkurs-basierten Bruttoinlandsprodukt als auch in Kaufkraftparität ist China die größte Volkswirtschaft Asiens und die zweitgrößte weltweit. In Asien folgen die Staaten Japan, Indien und Südkorea. Die Wirtschaft Japans war über Jahrzehnte die am stärksten wachsende Volkswirtschaft Asiens. Während Japans wirtschaftliche Lage sich seit den 1990er-Jahren verschlechterte, weisen China und Indien im selben Zeitraum ein, im globalen Vergleich, überdurchschnittliches Wirtschaftswachstum von mehr als 10 bzw. 7 Prozent pro Jahr auf. Japan hat aber die Rolle der führenden Wirtschaftsnation Asiens 2010 an China abgegeben. Dennoch ist es die führende Industrienation Asiens und (neben dem größtenteils zu Europa gezählten Russland) das einzige Land des Kontinents, das Mitglied der Gruppe der Acht führenden Industrieländer ist. Bezogen auf die Kaufkraftparität hat auch Indien heute (2015) ein größeres BIP als Japan.

    Tigerstaaten

    Bangkok, im Boom der Pantherstaaten rasch gewachsene Hauptstadt Thailands
    Reisanbau in Yunnan, China

    Nach dem Zweiten Weltkrieg, verstärkt ab den 1960er-Jahren, war das wirtschaftliche Wachstum zunächst auf die Länder und Gebiete entlang der Pazifikküste konzentriert, wovon vor allem Japan, Südkorea und Taiwan sowie die ehemaligen britischen Kolonien Hongkong und Singapur profitierten, die sich eng an die Wirtschaft der USA banden. In den 1980er-Jahren entwickelten sich mehrere Staaten in Ost- und Südostasien mit einem raschen Wirtschaftswachstum von Schwellenländern zu Industrieländern: die so genannten „Tigerstaaten“ Hongkong (damals noch eine Kronkolonie des Vereinigten Königreichs), Taiwan, Singapur und Südkorea. 1997/98 fand die rasante Hochkonjunktur in vielen dieser Länder mit der Asienkrise ihr Ende, die – von Thailand ausgehend – vor allem eine Finanz- und Währungskrise war. Seitdem wächst die Wirtschaft dieser Staaten zwar weiter, aber das sehr hohe Wachstum von bis zu zehn Prozent hat sich auf fünf bis sechs Prozent abgeschwächt.

    Entwicklungsländer

    Pflügen des Reisfeldes mit Wasserbüffel und Holzpflug in Vietnam
    Noch heute gebräuchlichstes Transportmittel in Myanmar
    Probebohrung in der Steppe von Kasachstan

    Weite Teile Asiens sind nach wie vor landwirtschaftlich geprägt, wobei insbesondere Reisanbau und Fischerei von Bedeutung sind.

    Rohstoffarme Staaten oder durch Kriege und korrupte Regierungen zurückgeworfene Staaten wie Afghanistan, Bangladesch, Myanmar, Laos, Kambodscha, Vietnam sowie die ehemaligen Sowjetrepubliken in Zentralasien sind nach wie vor landwirtschaftlich entsprechend ihrer Topographie geprägt.

    Die meisten heutigen zentral- und nordasiatische Staaten waren bis zu deren Zerfall 1990/91 Teil der Sowjetunion und somit planwirtschaftlich organisiert. Die Wirtschaft dieser Länder ist großteils von Landwirtschaft und Schwerindustrie bestimmt.

    Rohstoffreichtum einiger Regionen wie etwa Erdöl und -gas im Gebiet des Kaspischen Meeres oder diejenigen in der Tundra von Sibirien gewinnen Bedeutung im sich weltweit verstärkenden Kampf um diese Ressourcen wobei Fluch und Segen für die Bewohner häufig nahe beieinander liegen (Umweltverschmutzung, Korruption und Kriege).

    Golfstaaten

    In Südwestasien ist vor allem die Erdölförderung der bestimmende Wirtschaftszweig. Die weltweit größten bekannten Reserven befinden sich auf der arabischen Halbinsel und in den umliegenden Regionen am persischen Golf, wobei das Königreich Saudi-Arabien über die umfangreichsten Ölfelder verfügt. Weitere bedeutende Förderländer sind Iran und Irak. Die flächenmäßig kleinen Emirate Kuwait und Katar, die Vereinigten Arabischen Emirate und das Königreich Bahrain zählen durch den Verkauf von Erdöl bei zugleich relativ geringer Bevölkerungszahl zu den reichsten Staaten der Erde.

    Religion, Mythologie und Philosophie

    Quelle: Encyclopedia Britannica, zitiert in der FAZ vom 8. März 2013, Seite 6f

    Mehrere Regionen Asiens, darunter Mesopotamien, das Tal des Indus (vgl. Indus-Kultur), Iran und China, gelten als „Wiegen der Zivilisation“. Mit der Entwicklung der Zivilisationen und der frühen Hochkulturen in diesen Gebieten ging auch die Entwicklung der Religionen einher. Alle im Allgemeinen als „Weltreligionen“ bezeichneten Religionen haben ihren Ursprung in Asien. Mit über 1 Milliarde Anhänger ist der Islam die größte Religion in Asien und umfasst mehr als ein Viertel aller Bewohner des Kontinents, Muslime stellen die Bevölkerungsmehrheit in mehr als der Hälfte aller Staaten Asiens.[5][6]

    Vorderasien

    Zu den frühesten Monumenten religiösen Empfindens der Menschheit zählt etwa die Anlage in Göbekli Tepe in der heutigen Türkei. Entstanden um etwa 9000 v. Chr., wobei die Ursprünge noch deutlich weiter zurück reichen dürften, als die neolithische Revolution und damit der Beginn von Ackerbau und Viehzucht noch bevorstand, gilt Göbekli Tepe als älteste bekannte Tempelanlage der Welt. Etwa aus derselben Zeit datieren Funde in Nevalı Çori am Euphrat in der heutigen türkischen Provinz Şanlıurfa, wo auch vergleichbare bildhauerische Werke, wie anthropomorphe Figuren und Tierdarstellungen, die auf eine religiöse Nutzung hindeuten, gefunden wurden.

    Verehrung des Sonnengottes Schamasch (akkadisch-babylonisch)

    In Mesopotamien (Zweistromland; vgl. „Fruchtbarer Halbmond“) entwickelte sich ab etwa dem vierten Jahrtausend v. Chr. die sumerische Religion. Sie ist eine der ältesten bekannten Religionen und hatte entscheidenden Einfluss auf sich später entwickelnde Glaubenssysteme der Kanaaniter (Vorläufer der Hebräer), Akkader, Babylonier, Assyrer, Hethiter, Hurriter, Ugariter und Aramäer. Neben einer Reihe von den Haupt- und Urgöttern verehrten die Sumerer, in einer Zeit als dort einige der ersten Städte wie Ur und Byblos entstanden (vgl. Liste historischer Stadtgründungen), Stadtgötter und verfügten damit bereits über ein Pantheon von Göttern. Das Gilgamesch-Epos, eines der frühesten schriftlichen Zeugnisse der Menschheit, hat seinen Ursprung in dieser Epoche und erzählt von den Begegnungen des Königs Gilgamesch mit den Göttern und seiner Suche nach Unsterblichkeit. Das Enūma eliš (niedergeschrieben ca. im 12. Jahrhundert v. Chr.) ist wiederum einer der ursprünglichsten Schöpfungs-Mythen. Sumerische Mythen, wie etwa die Erzählung von der Sintflut, fanden auch Eingang in die judäo-christlichen Traditionen.

    Vermutlich in Baktrien entstand zwischen 1800 v. Chr. und 700 v. Chr. der Zoroastrismus, eine der ältesten, wenn auch ursprünglich dualistischen, monotheistischen (Ahura Mazda) Religionen, die bis heute überdauert hat.

    Die Richter (ca. 1250 v. Chr.) und die Erzväter, die als früheste Überlieferungen der jüdischen Geschichte gelten, hatten ihren Ursprung in Mesopotamien, wo die Vorfahren der Hebräer als Nomadenvolk lebten. Abraham, der Stammvater Israels, soll selbst aus Ur gekommen sein. Tradiert ist die jüdische Religion in einer in der Tora festgehaltenen schriftlichen und einer mündlichen Lehre (Talmud u. a.).

    Nestorianischer Priester (Bezeklik, Taklamakan)

    Mit Jesus von Nazaret (vgl. Jesus Christus) soll etwa 7 bis 4 v. Chr. in Palästina der selbst in der Tradition der jüdischen Religion stehende Begründer des Christentums geboren worden sein. Nach seinem Tod fand die Lehre seiner Jünger vorerst im Nahen Osten und, innerhalb des Römischen Reiches, in Südeuropa Verbreitung. In Asien entwickelten sich verschiedene Traditionen des christlichen Orients, von denen einige, wie etwa der Nestorianismus, bis weit nach Zentralasien und China vordrangen. Ausgehend vom byzantinischen Reich verbreiteten sich die altorientalischen Kirchen in Vorderasien und auch Indien, sowie die heute noch in weiten Teilen Nordasiens vorherrschenden orthodoxen Kirchen.

    Die Geschichte des Islam begann im 6. Jahrhundert mit dem Wirken Mohammeds auf der arabischen Halbinsel. Gemäß der im Koran festgehaltenen Lehre des Islam gilt er als der letzte Prophet in der Geschichte der Menschheit und Vollender der biblischen Prophetie. In Asien fand der Islam im Zuge der islamischen Expansion Verbreitung im Nahen Osten und in weiten Teilen Zentral- und Südasiens bis zum Malaiischen Archipel im Südosten.

    Süd- und Ostasien

    Gopuram eines Hindu-Tempels in Hampi (Indien)

    Der bis heute vor allem in Indien vorherrschende Hinduismus entstand gegen Ende der Indus-Kultur um ca. 2000 v. Chr. Die Lehren basieren auf den Veden, heiligen Schriften, deren älteste, die Rigveda, etwa 1200 bis 1000 v. Chr. zusammengestellt wurde. Der Hinduismus umfasst eine große Zahl teils sehr unterschiedlicher Glaubensschulen und Ansichten. Es gibt weder ein gemeinsames Glaubensbekenntnis noch Institutionen, die für alle Gläubigen gleichermaßen Autorität besitzen. Verbindende Merkmale sind die zentralen Gottheiten Brahma, Shiva und Vishnu (Trimurti) – die jedoch in den Lehrtraditionen wie Shivaismus, Vishnuismus oder Shaktismus sehr unterschiedlich betrachtet werden – und der Glaube an den sich ständig wiederholenden Kreislauf des Lebens (Samsara) und die Reinkarnation. Der Hinduismus hatte, wie die indische Philosophie, schon früh prägenden Einfluss auf jene Länder, die im Einflussbereich der indischen Kultur lagen, und fand Eingang in die Glaubenswelten Süd- und Südostasiens.

    An der Wende vom sechsten zum fünften vorchristlichen Jahrhundert lebte in Nordindien Siddhartha Gautama, der nach der Überlieferung im Alter von 35 Jahren Erleuchtung erlangte und somit zum Buddha („Erwachter“, „Erleuchteter“) wurde. Aus der vedischen Tradition kommend und diese hinter sich lassend, wurde er zum Begründer des Buddhismus. Etwa zeitgleich begründete Mahavira ebenfalls in Indien die Lehre des Jainismus.

    Der Buddhismus wurde vorerst auf dem indischen Subkontinent, auf Sri Lanka und in Zentralasien bekannt. Der südliche Buddhismus (Theravada) fand Verbreitung in den Ländern Südostasiens. Der nördliche Buddhismus (Mahayana) erreichte über die Seidenstraße Zentral- und Ostasien, sowie von Nordindien die Länder der Himalayaregion, wo sich, in Wechselwirkung mit den bereits verbreiteten Glaubenssystemen wie etwa Bön, weitere Traditionen entwickelten; so beispielsweise Vajrayana (Tibet), Chan (China) bzw. Zen (Japan) und Amitabha-Buddhismus (Ostasien).

    Tàijí-Symbol (auch „Yīn und Yáng“-Symbol)

    In China hatten die Philosophen Laozi (auch Lao Tse, Lao-tzu; 6. Jahrhundert v. Chr., ob er tatsächlich existiert hat, ist nicht endgültig geklärt) und Konfuzius (auch Kong Tse, Kǒng Fū Zǐ; ca. 551 v. Chr. bis 479 v. Chr.) die Lehrtraditionen des Daoismus und des Konfuzianismus begründet, die bis heute prägenden Einfluss auf die Gedankenwelt und Gesellschaft Ostasiens besitzen und auch die Entwicklung des Buddhismus in diesen Regionen mitbeeinflussten (vgl. Buddhismus in China).

    Die Religion in Japan war schon früh durch den Synkretismus verschiedener Glaubenssysteme gekennzeichnet. Bis heute sind Shintō und Buddhismus (Zen, Amidismus), der Japan im 5. oder 6. Jahrhundert erreichte, die am weitesten verbreiteten Religionen. Inhalte der chinesischen Lehren Daoismus und Konfuzianismus wurden von Shintō und Buddhismus aufgenommen und integriert. Seit dem Ende des Zweiten Weltkriegs herrscht eine besonders hohe religiöse Toleranz in Japan, was zu einem starken Anwachsen neureligiöser Gruppen geführt hat.

    An der Wende vom 15. zum 16. Jahrhundert stiftete Guru Nanak im Punjab, im Nordwesten Indiens, den Sikhismus. Oft als Abspaltung oder Reformbewegung des Hinduismus oder als Synkretismus aus Hinduismus und Islam bezeichnet, beschreiben Sikhs ihren Glauben als religionsübergreifenden Lebensweg, der sich nicht an dogmatischen Grenzen, sondern an gelebter Weisheit orientiert.

    Offiziell am 7. September 1926 im südlichen Vietnam gegründet, ist der Caodaismus (Đạo Cao Đài) heute nach Buddhismus und Katholizismus die drittgrößte Religion des Landes. Religionsstifter war Ngô Văn Chiêu, der die Lehren dieser Religion, die verschiedene Inhalte aus mehreren asiatischen Religionen und dem Christentum umfasst, durch spiritistische Sitzungen empfangen hatte.

    Im 20. Jahrhundert hatten so unterschiedliche Persönlichkeiten wie der Inder Mahatma Gandhi, mit seiner aus der indischen Philosophie abgeleiteten Lehre der Gewaltlosigkeit (Ahimsa), und der chinesische Revolutionär Mao Zedong, mit seinem auf dem Kommunismus basierenden Maoismus, entscheidenden Einfluss auf die Politik der beiden nach ihrer Bevölkerungszahl größten Länder der Erde und darüber hinaus.

    Länder Asiens nach Regionen

    AustralienPapua-NeuguineaVereinigte StaatenDiego GarciaAustralienMadagaskarSeychellenSomaliaDschibutiEritreaÄthiopienSudanÄgyptenLibyenZypernTürkeiGriechenlandTunesienAlgerienMaltaVereinigtes KönigreichNorwegenSchwedenFinnlandPortugalSpanienFrankreichFrankreichItalienEstlandLettlandLitauenRusslandWeißrusslandUkraineMoldauPolenDänemarkBelgienNiederlandeLuxemburgSchweizÖsterreichTschechienDeutschlandSlowakeiSlowenienKroatienMontenegroAlbanienUngarnBosnien und HerzegowinaSerbienNordmazedonienBulgarienRumänienGeorgienArmenienAserbaidschanAserbaidschanRusslandIrakSyrienLibanonIsraelJordanienKuwaitKatarBahrainSaudi-ArabienJemenOmanVereinigte Arabische EmirateIranTurkmenistanUsbekistanKirgisistanTadschikistanPakistanAfghanistanKasachstanMongoleiMaledivenJapanNordkoreaSüdkoreaRepublik China (Taiwan)IndienSri LankaBhutanNepalBangladeschMyanmarThailandKambodschaLaosVietnamPhilippinenVolksrepublik ChinaSingapurOsttimorBruneiMalaysiaIndonesien
    Länder Asiens
    LandHauptstadtFläche (km²)Bevölkerung 2016[7]
    Nordasien
    RusslandRussland Russland* (ohne europäischen Teil)Moskau13.122.850 (nur asiatischer Teil)etwa 38 Mio. (nur asiatischer Teil)
    Ostasien
    China VolksrepublikVolksrepublik China Volksrepublik ChinaPeking9.572.4191.380.000.000
    TaiwanRepublik China (Taiwan) Republik China (Taiwan)Taipeh
    35.98023.500.000
    JapanJapan JapanTokio377.835126.900.000
    MongoleiMongolei MongoleiUlaanbaatar1.565.5003.000.000
    Korea NordNordkorea NordkoreaPjöngjang122.76225.000.000
    Korea SudSüdkorea SüdkoreaSeoul99.39250.700.000
    Südasien
    AfghanistanAfghanistan AfghanistanKabul647.50032.200.000
    BangladeschBangladesch BangladeschDhaka144.000160.400.000
    BhutanBhutan BhutanThimphu47.000800.000
    IndienIndien IndienNeu-Delhi3.287.5901.314.100.000
    MaledivenMalediven MaledivenMalé298300.000
    NepalNepal NepalKathmandu147.18128.000.000
    PakistanPakistan PakistanIslamabad803.940199.000.000
    Sri LankaSri Lanka Sri LankaColombo65.61020.900.000
    Südostasien
    BruneiBrunei BruneiBandar Seri Begawan5.770400.000
    IndonesienIndonesien IndonesienJakarta1.912.988255.700.000
    KambodschaKambodscha KambodschaPhnom Penh181.04015.400.000
    LaosLaos LaosVientiane236.8006.900.000
    MalaysiaMalaysia MalaysiaKuala Lumpur329.75030.800.000
    MyanmarMyanmar MyanmarNaypyidaw676.60052.100.000
    PhilippinenPhilippinen PhilippinenManila300.000103.000.000
    SingapurSingapur SingapurSingapur6825.500.000
    ThailandThailand ThailandBangkok513.11565.100.000
    OsttimorOsttimor OsttimorDili15.0071.200.000
    VietnamVietnam VietnamHanoi331.69091.700.000
    Vorderasien
    AgyptenÄgypten Ägypten (nur die Halbinsel Sinai)Kairo60.000 (nur der Sinai)≈1.300.000 (nur auf dem Sinai)
    ArmenienArmenien ArmenienJerewan29.8003.000.000
    AserbaidschanAserbaidschan AserbaidschanBaku86.6009.700.000
    BahrainBahrain BahrainManama7111.400.000
    GeorgienGeorgien GeorgienTiflis69.7003.800.000
    IrakIrak IrakBagdad437.07237.100.000
    IranIran IranTeheran1.648.19578.500.000
    IsraelIsrael IsraelJerusalem22.3808.400.000
    JemenJemen JemenSanaa527.97026.700.000
    JordanienJordanien JordanienAmman89.3428.100.000
    KatarKatar KatarDoha11.4372.400.000
    KuwaitKuwait KuwaitKuwait-Stadt17.8203.800.000
    LibanonLibanon LibanonBeirut10.4526.200.000
    OmanOman OmanMaskat309.5004.200.000
    Palastina AutonomiegebietePalästina Palästina**Ramallah6.2204.500.000
    Saudi-ArabienSaudi-Arabien Saudi-ArabienRiad2.240.00031.600.000
    SyrienSyrien SyrienDamaskus185.18017.100.000
    TurkeiTürkei Türkei (ohne europäisches Ostthrakien)Ankara779.45267.000.000
    Vereinigte Arabische EmirateVereinigte Arabische Emirate Vereinigte Arabische EmirateAbu Dhabi83.6009.600.000
    Zypern RepublikRepublik Zypern Zypern*Nikosia9.251775.927
    Zentralasien
    KasachstanKasachstan Kasachstan (ohne europäischen Teil)Nur-Sultan2.717.30017.500.000
    KirgisistanKirgisistan KirgisistanBischkek198.5006.000.000
    TadschikistanTadschikistan TadschikistanDuschanbe143.1008.500.000
    TurkmenistanTurkmenistan TurkmenistanAşgabat488.1005.400.000
    UsbekistanUsbekistan UsbekistanTaschkent447.40031.300.000

    * wird politisch und kulturell Europa zugerechnet

    ** umstrittener Staat

    Als zwei weitere Staaten wurden seit 2008 Abchasien und Südossetien von Russland und vier nichtasiatischen Staaten anerkannt, von den übrigen Staaten jedoch weiterhin als Teil Georgiens betrachtet. Die türkisch besetzte Türkische Republik Nordzypern ist nur von der Türkei anerkannt. Das mit armenischer Hilfe von Aserbaidschan abgespaltene Bergkarabach wird zwar selbst von Armenien nicht anerkannt, jedoch von Abchasien und Südossetien. Auch die Autonome Region Kurdistan im Nordirak strebte ursprünglich die Unabhängigkeit an, hat sich jedoch in einem Grundlagenvertrag mit der Zentralregierung in Bagdad auf Autonomie innerhalb des Irak verständigt. Der aus den Palästinensischen Autonomiegebieten hervorgegangene Staat Palästina ist zwar Beobachterstaat in der UNO, jedoch kein UNO-Mitgliedsstaat. Bereits 1988 war die palästinensische Staatsgründung von über 100 Staaten (darunter DDR und Vatikan) anerkannt worden, zu denen Palästina diplomatische Beziehungen unterhält. International nicht anerkannt ist der Islamische Staat, der sich spätestens seit 2014 über weite Teile Iraks und Syriens erstreckt und die im 20. Jahrhundert entstandene staatliche Gliederung Westasiens in Frage stellt.

    Wirtschaftliche und politische Bündnisse und Organisationen

    Arabische Liga

    Die Arabische Liga wurde als Verbund arabischer Staaten am 22. März 1945 in Kairo gegründet, wo sie auch ihren Sitz hat. Sie besteht aus 22 Mitgliedsstaaten: 21 Nationalstaaten in Afrika und Asien sowie Palästina. Hauptziel der Arabischen Liga sind die Förderung der Beziehungen der Mitgliedsstaaten auf politischem, kulturellem, sozialem und wirtschaftlichem Gebiet. Die Unabhängigkeit und Souveränität der Mitgliedsstaaten und der arabischen Außeninteressen soll bewahrt und Streit innerhalb der Liga geschlichtet werden. Beschlüsse der Liga sind nur bindend für jene Staaten, die ihnen zugestimmt haben. Mitgliedsstaaten aus Asien sind: Bahrain, Irak, Jemen, Jordanien, Katar, Kuwait, Libanon, Oman, Palästina, Saudi-Arabien, Syrien und die Vereinigten Arabischen Emirate. Innerhalb der Liga bilden Saudi-Arabien, Kuwait, Bahrain, Katar, die VAE und Oman den Golf-Kooperationsrat.

    Im September 1960 gründeten Iran, Irak, Kuwait, Saudi-Arabien und der südamerikanische Staat Venezuela in Bagdad die OPEC (Organisation Erdöl exportierender Länder), der später auch die Ölförderländer Katar (1961), Indonesien (1962) und die Vereinigten Arabischen Emirate (1967) beitraten. Die OPEC-Mitgliedsstaaten aus Asien, Afrika und Südamerika fördern zusammen etwa 40 % der weltweiten Erdölproduktion und verfügen über rund drei Viertel der weltweiten Erdölreserven. Ziele der OPEC sind eine gemeinsame Ölpolitik, um sich gegen einen Preisverfall abzusichern und zugleich die weltweite Ölversorgung sicherzustellen. Über die Festlegung von Förderquoten für die einzelnen OPEC-Mitglieder wird die Erdölproduktion geregelt. Neben der OPEC sind eine Reihe von Staaten auch in der OAPEC (Organisation der arabischen Erdöl exportierenden Staaten) vertreten, die 1968 von Kuwait, Libyen und Saudi-Arabien als Zusammenschluss politisch konservativer arabischer Länder Asiens und Nordafrikas und Gegenpol zur OPEC geschaffen wurde. Weitere Mitglieder aus Asien sind heute Bahrain, Irak, Katar, Syrien und die Vereinigten Arabischen Emirate.

    ASEAN und ASEAN Plus Three

    Die ASEAN (Verband Südostasiatischer Nationen) wurde am 8. August 1967 als politische, wirtschaftliche und kulturelle Vereinigung der südostasiatischen Staaten Thailand, Indonesien, Malaysia, Philippinen und Singapur gegründet. Ziel war und ist die Zusammenarbeit in der Förderung des wirtschaftlichen Aufschwungs, des sozialen Fortschritts und der politischen Stabilität in der Region. Gegründet in der Zeit des „Kalten Krieges“, war das Bündnis von Anfang an kapitalistisch-marktwirtschaftlich und auf die Zusammenarbeit mit den westlichen Industrienationen ausgerichtet und stand in Konkurrenz zur kommunistisch-planwirtschaftlichen Volksrepublik China. 1984 trat das Sultanat Brunei der ASEAN bei, 1995 Vietnam, 1997 Myanmar und Laos sowie 1999 Kambodscha. Papua-Neuguinea hat den Status eines Beobachters. Am 1. Januar 2003 wurde mit der Etablierung der ASEAN-Freihandelszone (AFTA) eine Freihandelszone geschaffen, der alle Mitgliedsstaaten der ASEAN angehören. Australien und Neuseeland stehen in Verhandlungen, um diesem Freihandelsabkommen beizutreten. ASEAN plus Drei bezeichnet die gemeinsame Konferenz der ASEAN-Staaten mit China, Japan und Südkorea. In Thailand wurde 2000 die Chiang-Mai-Initiative begründet, die eine enge Kooperation der ASEAN plus Drei-Länder im Finanzsektor festlegt.

    ECO

    Iran, Pakistan und die Türkei gründeten 1985 die Organisation für wirtschaftliche Zusammenarbeit (ECO), aus der eine Freihandelszone entstehen sollte. Seit der Auflösung der Sowjetunion traten auch Afghanistan, Aserbaidschan, Kasachstan, Kirgisistan, Tadschikistan, Turkmenistan und Usbekistan dem Kooperationsbündnis bei. Internationale Bedeutung kommt ihm vor allem durch den Reichtum an Bodenschätzen in einigen Mitgliedsländern und durch die strategische Lage als Transitkorridor für diese Güter sowohl nach Europa wie auch nach China zu.

    APEC

    Auf Initiative der USA, Japans und Australiens wurde 1989 die Asiatisch-Pazifische Wirtschaftsgemeinschaft (APEC) geschaffen, deren Ziel die Einrichtung einer alle Pazifik-Anrainerstaaten umfassenden Freihandelszone in zwei Schritten ist: Ab 2010 sollen die Freihandelsabkommen für die Industrienationen der Regionen gelten, ab 2020 auch für die Entwicklungsländer. Asiatische Mitglieder der APEC sind Brunei, die Volksrepublik China, Indonesien, Japan, Malaysia, Papua-Neuguinea, die Philippinen, Russland, Singapur, Südkorea, Taiwan, Thailand und Vietnam.

    Das Asien-Europa-Treffen (Asia-Europe Meeting: ASEM) dient der Beratung und multilateralen Gesprächen zwischen Europa und Asien über eine Zusammenarbeit in Wirtschaft, Politik, Bildung und Kultur. Der Vorschlag zu diesem Treffen kam vom damaligen Premierminister von Singapur Goh Chok Tong und wurde im März 1996 umgesetzt. Mitglieder aus Asien sind: Brunei, die Volksrepublik China, Indonesien, Japan, Kambodscha, Laos, Malaysia, Myanmar, Philippinen, Singapur, Südkorea, Thailand und Vietnam.

    1997 wurde die Gruppe der acht Entwicklungsländer (D-8) gegründet, der neben Ägypten und Nigeria die asiatischen Staaten Bangladesch, Indonesien, Iran, Malaysia, Pakistan und die Türkei angehören. Ziel der D-8 ist es, ihre Stellung in der Weltwirtschaft zu verbessern, Handelsbeziehungen zu diversifizieren und neue Handelsbeziehungen zu schaffen, die Teilhabe bei Entscheidungen auf internationaler Ebene auszubauen und so für bessere Lebensbedingungen der Menschen in Entwicklungsländern zu sorgen.

    SCO
  • Mitgliedsstaaten
  • Beobachterstatus
  • Die Shanghai Cooperation Organisation (SCO; auch: Shanghaier Organisation für Zusammenarbeit, SOZ) ging 2001 aus der Shanghai-Five-Gruppe hervor, die in erster Linie der militärischen Zusammenarbeit der Mitgliedsländer und der Reduktion der Militärpräsenzen an den gemeinsamen Grenzen dienen sollte. Zu den ursprünglichen Mitgliedsstaaten Volksrepublik China, Russland, Kasachstan, Kirgisistan und Tadschikistan kam mit Gründung der SCO Usbekistan hinzu. Die Mongolei, Indien, Pakistan und der Iran befinden sich im Beobachterstatus. Besonders Indien wird zu einer vollen Mitgliedschaft ermutigt. Neben der Verbesserung der politischen Stabilität in der Region, wozu auch ein Antiterrornetzwerk (Regional Antiterrorism Structure, RATS) eingerichtet wurde, werden langfristig eine gemeinsame Außenpolitik und die Schaffung einer Freihandelszone angestrebt.

    Im Vorfeld der fünften ministeriellen Konferenz der Welthandelsorganisation (WTO) in Cancún (Mexiko) wurde am 20. August 2003 die G20 (zeitweise auch G21, G22 oder G20+) als gemeinsame Plattform für Entwicklungs- und Schwellenländer und Gegengewicht zu den USA und der EU geschaffen. Neben Brasilien sind die Volksrepublik China und Indien darin die führenden Kräfte. Mitglieder sind auch Indonesien, Pakistan, die Philippinen und Thailand.

    Seit 2002 kooperien 30 asiatische Staaten aus allen Regionen im Asian Cooperation Dialogue. Jährliche Treffen vor allem der Außen-, Finanz- und Wirtschaftsminister sollen zu einer verstärkten Zusammenarbeit beitragen.

    Weitere wichtige asiatische Organisationen sind: die Organisation der Islamischen Konferenz, die Asiatische Entwicklungsbank (Asia Development Bank, ADB) und die Asiatische Menschenrechtskommission.

    Siehe auch

    Weblinks

    Commons: Asien – Sammlung von Bildern, Videos und Audiodateien
    Wikiquote: Asien – Zitate
    Wiktionary: Asien – Bedeutungserklärungen, Wortherkunft, Synonyme, Übersetzungen
     Wikinews: Asien – in den Nachrichten
    Wikisource: Asien – Quellen und Volltexte
    Wikivoyage: Asien – Reiseführer

    Einzelnachweise

    1. Eintrag „Asia“ im Online Etymology Dictionary.
    2. Standard Country or Area Codes for Statistical Use (M49 Standard). UN Statistica Division, abgerufen am 2. Mai 2020 ("Geographic Regions" anklicken). Zitat: "The assignment of countries or areas to specific groupings is for statistical convenience and does not imply any assumption regarding political or other affiliation of countries or territories by the United Nations."
    3. United Nations, Department of Economic and Social Affairs: World Population Prospects: The 2010 Revision, Daten online abrufbar
    4. Statistik Lebenserwartungen
    5. Frankfurter Allgemeine Zeitung vom 8. März 2013, Seiten 6–7: Die Weltreligionen
    6. Time Almanac (powered by Encyclopaedia Britannia) 2010, Seite 508. Chicago 2010
    7. DSW-Datenreport 2016. (PDF) Stiftung Weltbevölkerung, abgerufen am 29. Oktober 2017.

    Auf dieser Seite verwendete Medien

    Terrace field yunnan china.jpg
    Autor/Urheber: Jialiang Gao, www.peace-on-earth.org, Lizenz: CC-BY-SA-3.0
    Terrace rice fields in Yunnan Province, China
    Bangkok Skytrain Saladaeng.jpg
    Bangkok Skytrain, BTS Skytrain approaching Sala Daeng Station near the famous Patpong district of Bangkok
    Flag of Nepal (with spacing).svg
    Die Flagge von Nepal mit rechtem Rand (Seitenverhältnis 3:4)
    AIDS and HIV prevalence 2008.svg
    HIV/AIDS prevelance worldmap
    Tundra in Siberia.jpg
    Autor/Urheber: Dr. Andreas Hugentobler, Lizenz: CC BY 2.0 de
    Tundra bei Dudinka am Jenissej in Sibirien
    Location-Asia-UNsubregions.png
    Karte Asiens, Regionen nach [1]:
    •   Gebiete, die ganz oder teilweise in Osteuropa liegen
    •   Gebiete, die ganz oder teilweise in Melanesien liegen
    Museum für Indische Kunst Dahlem Berlin Mai 2006 061.jpg
    Three Magi (?) Palm Sunday (?), Khocho, Nestorian Temple, 683770 CE. Wall painting, 61 × 67 cm. Located in the Museum für Indische Kunst, Berlin-Dahlem.
    Asia on the globe (white-red).svg
    Autor/Urheber: TUBSEmail Silk.svg Gallery, Lizenz: CC BY-SA 3.0
    Lage von XY (siehe Dateiname) auf der Erde.
    Dorasan.jpg
    Autor/Urheber: unknown, Lizenz: CC-BY-SA-3.0
    The Dorasan-Station at the frontier between north and south korea
    Shinkansen.jpg
    • Shinkansen Abbildung mehrerer Züge
    • Quelle: [1]
    • public domain
    • Größe: 200,3 KB
    Flag of Syria.svg
    Das Bild dieser Fahne lässt sich leicht mit einem Rahmen versehen
    Burma07.jpg
    Autor/Urheber: Bild von Stefan Grünig, CH-3752 Wimmis (de:Benutzer:Sgruenig), Lizenz: CC-BY-SA-3.0
    Noch immer ist der de:Ochsenkarren in Burma eines der wichtigsten Transportmittel
    Flag of Iran.svg
    Flagge des Irans. Die dreifarbige Flagge wurde 1906 eingeführt, aber nach der Islamischen Revolution von 1979 wurden die Arabische Wörter 'Allahu akbar' ('Gott ist groß'), in der Kufischen Schrift vom Koran geschrieben und 22-mal wiederholt, in den roten und grünen Streifen eingefügt, so daß sie an den zentralen weißen Streifen grenzen.
    Registan square Samarkand.jpg
    Autor/Urheber: Ekrem Canli, Lizenz: CC BY-SA 3.0
    Registan square after sunset in Samarkand, Uzbekistan
    Flag of Laos.svg
    Die Flagge von Laos
    Weltarmut.png

    Die ärmsten Länder der Welt: Länder mit einem durchschnittlichen Pro-Kopf-Einkommen < 745$. Sogenannte "low income country" nach Daten der Weltbank (2001).

    Source: Selbst erstellt (Weltkarte aus der Wikimedia Common).
    Steppe-2003.JPG
    Autor/Urheber: Die Autorenschaft wurde nicht in einer maschinell lesbaren Form angegeben. Es wird Heinrich~commonswiki als Autor angenommen (basierend auf den Rechteinhaber-Angaben)., Lizenz: CC BY 2.5

    Author: Jürgen Höbig, Burkhard Heuel-Fabianek (Research Center Juelich (S)) Url: http://www.fz-juelich.de/gs/genehmigungen/forschung-sg/kasachstan-1

    subject: drill rig on the Semipalatinsk Test Site (STS) in the steppe region of Kazakhstan
    Flag of Afghanistan.svg
    Flagge der Islamischen Republik Afghanistan.
    Asia map pastel de.png

    Political map of Asia, captions in german language.

    • creator: Tsui 20:28, 18 January 2006 (UTC)
    • date: 18.01.2006
    Flag of Maldives.svg
    Flagge der Malediven.
    Malaria distribution (de).png
    Autor/Urheber: S. Jähnichen, Lizenz: CC-BY-SA-3.0
    spread of malaria, 2005
    Borobudur-perfect-buddha.jpg
    (c) Nappio aus der englischsprachigen Wikipedia, CC-BY-SA-3.0
    The perfect Buddha at the Borobudur (Java, Indonesia), ca. 750 - 850 AD
    ECO Map.png
    Autor/Urheber: Die Autorenschaft wurde nicht in einer maschinell lesbaren Form angegeben. Es wird Aris Katsaris als Autor angenommen (basierend auf den Rechteinhaber-Angaben)., Lizenz: CC BY 2.5
    Map of the Economic Cooperation Organization. Created by User:Aris Katsaris, by modifying Image:Turkestan.png. Aris Katsaris 06:04, 15 March 2006 (UTC)
    ASEAN Plus Three members.png
    Autor/Urheber: rdb, Lizenz: CC-BY-SA-3.0
    Weltkarte, Mitglieder der ASEAN Plus Three grün hervorgehoben; reguläre ASEAN-Mitglieder hellgrün
    Karnataka Hampi IMG 0730.jpg
    (c) Ajar, CC-BY-SA-3.0
    Virupaksha temple at Hampi
    Cylinder seal Shamash Louvre AO9132.jpg
    Cult scene: the worship of the sun-god, Shamash. Limestone cylinder-seal, Mesopotamia.
    Asia, administrative divisions - de - colored.svg
    Autor/Urheber: TUBSEmail Silk.svg Gallery, Lizenz: CC BY-SA 3.0
    Karte der politischen Gliederung von XY (siehe Dateiname)
    Rice Cultivation Vietnam.1024x768.jpg
    Autor/Urheber: Thomas Schoch, Lizenz: CC BY-SA 2.5
    Paddy farmers, Rice Cultivation in Vietnam
    Yin yang.svg
    This is the Taijitu (太極圖), with black representing yin and white representing yang. It is a symbol that reflects the inescapably intertwined duality of all things in nature, a common theme in Taoism. No quality is independent of its opposite, nor so pure that it does not contain its opposite in a diminished form: these concepts are depicted by the vague division between black and white, the flowing boundary between the two, and the smaller circles within the large regions.
    Kreisdiagramm-Asien-Religionen.svg
    Autor/Urheber:

    selbst erstellt

    , Lizenz: CC-by-sa 3.0

    Religionen in Asien

    APEC members 180E.svg
    A map of current APEC members. Map centred in the Pacific ocean at 180E.